Lineage for d1z7zi1 (1z7z I:83-187)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026100Family b.1.1.3: C2 set domains [49142] (8 protein domains)
  6. 2026164Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 2026165Species Human (Homo sapiens) [TaxId:9606] [49146] (6 PDB entries)
  8. 2026172Domain d1z7zi1: 1z7z I:83-187 [124680]
    Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5
    automatically matched to d1ic1a1
    complexed with nag, ndg

Details for d1z7zi1

PDB Entry: 1z7z (more details), 8 Å

PDB Description: Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1z7zi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7zi1 b.1.1.3 (I:83-187) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvl

SCOPe Domain Coordinates for d1z7zi1:

Click to download the PDB-style file with coordinates for d1z7zi1.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi1: