Lineage for d1z7ya1 (1z7y A:3-322)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709069Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 709093Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142745] (2 PDB entries)
  8. 709095Domain d1z7ya1: 1z7y A:3-322 [124679]
    complexed with aa5; mutant

Details for d1z7ya1

PDB Entry: 1z7y (more details), 2.7 Å

PDB Description: crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant
PDB Compounds: (A:) Cysteine synthase

SCOP Domain Sequences for d1z7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ya1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sriakdvteligntplvylnnvaegcvgrvaaklemmepcssvadrigfsmisdaekkgl
ikpgesvlieptsgntgvglaftaaakgykliitmpasmsterriillafgvelvltdpa
kgmkgaiakaeeilaktpngymlqqfenpanpkihyettgpeiwkgtggkidgfvsgigt
ggtitgagkylkeqnanvklygvepvesailsggkpgphkiqgigagfipsvlnvdlide
vvqvssdesidmarqlalkegllvgissgaaaaaaiklaqrpenagklfvaifpsfgery
lstvlfdatrkeaeamtfea

SCOP Domain Coordinates for d1z7ya1:

Click to download the PDB-style file with coordinates for d1z7ya1.
(The format of our PDB-style files is described here.)

Timeline for d1z7ya1: