![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142745] (2 PDB entries) Uniprot P47998 3-322 |
![]() | Domain d1z7ya1: 1z7y A:3-322 [124679] complexed with aa5; mutant |
PDB Entry: 1z7y (more details), 2.7 Å
SCOPe Domain Sequences for d1z7ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ya1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sriakdvteligntplvylnnvaegcvgrvaaklemmepcssvadrigfsmisdaekkgl ikpgesvlieptsgntgvglaftaaakgykliitmpasmsterriillafgvelvltdpa kgmkgaiakaeeilaktpngymlqqfenpanpkihyettgpeiwkgtggkidgfvsgigt ggtitgagkylkeqnanvklygvepvesailsggkpgphkiqgigagfipsvlnvdlide vvqvssdesidmarqlalkegllvgissgaaaaaaiklaqrpenagklfvaifpsfgery lstvlfdatrkeaeamtfea
Timeline for d1z7ya1: