Lineage for d1z7wa1 (1z7w A:3-322)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907502Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2907542Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142745] (2 PDB entries)
    Uniprot P47998 3-322
  8. 2907543Domain d1z7wa1: 1z7w A:3-322 [124674]
    complexed with plp, so4

Details for d1z7wa1

PDB Entry: 1z7w (more details), 2.2 Å

PDB Description: Crystal Structure of O-Acetylserine Sulfhydrylase from Arabidopsis thaliana
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d1z7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sriakdvteligntplvylnnvaegcvgrvaaklemmepcssvkdrigfsmisdaekkgl
ikpgesvlieptsgntgvglaftaaakgykliitmpasmsterriillafgvelvltdpa
kgmkgaiakaeeilaktpngymlqqfenpanpkihyettgpeiwkgtggkidgfvsgigt
ggtitgagkylkeqnanvklygvepvesailsggkpgphkiqgigagfipsvlnvdlide
vvqvssdesidmarqlalkegllvgissgaaaaaaiklaqrpenagklfvaifpsfgery
lstvlfdatrkeaeamtfea

SCOPe Domain Coordinates for d1z7wa1:

Click to download the PDB-style file with coordinates for d1z7wa1.
(The format of our PDB-style files is described here.)

Timeline for d1z7wa1: