SCOPe 2.06: Domain d1z7ub2: 1z7u B:1-107

Lineage for d1z7ub2 (1z7u B:1-107)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (6 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)

6. Protein automated matches [190851] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [188172] (1 PDB entry)

8. Domain d1z7ub2: 1z7u B:1-107 [124673]
   Other proteins in same PDB: d1z7ua1, d1z7ua2, d1z7ub3
   automated match to d1z7ua1
   complexed with fmt

Details for d1z7ub2

PDB Entry: 1z7u, 2.2 Å

PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583

PDB Compounds: (B:) hypothetical protein EF0647

SCOPe Domain Sequences for d1z7ub2:

Sequence; same for both SEQRES and ATOM records:

>d1z7ub2 a.4.5.69 (B:1-107) automated matches {Enterococcus faecalis [TaxId: 226185]}
mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd
glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl

Timeline for d1z7ub2:

• d1z7ub2 first appeared in SCOP 1.73, called d1z7ub1
  
• d1z7ub2 was called d1z7ub_ in SCOPe 2.05
  
• d1z7ub2 appears in SCOPe 2.07
  
• d1z7ub2 appears in the current release, SCOPe 2.08