Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (6 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801) |
Protein automated matches [190851] (1 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [188172] (1 PDB entry) |
Domain d1z7ub_: 1z7u B: [124673] Other proteins in same PDB: d1z7ua1 automated match to d1z7ua1 complexed with fmt |
PDB Entry: 1z7u (more details), 2.2 Å
SCOPe Domain Sequences for d1z7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ub_ a.4.5.69 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]} snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl
Timeline for d1z7ub_: