Lineage for d1z7ub_ (1z7u B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722753Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 1722772Protein automated matches [190851] (1 species)
    not a true protein
  7. 1722773Species Enterococcus faecalis [TaxId:226185] [188172] (1 PDB entry)
  8. 1722774Domain d1z7ub_: 1z7u B: [124673]
    Other proteins in same PDB: d1z7ua1
    automated match to d1z7ua1
    complexed with fmt

Details for d1z7ub_

PDB Entry: 1z7u (more details), 2.2 Å

PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
PDB Compounds: (B:) hypothetical protein EF0647

SCOPe Domain Sequences for d1z7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ub_ a.4.5.69 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
snamttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlrem
ekdglvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl

SCOPe Domain Coordinates for d1z7ub_:

Click to download the PDB-style file with coordinates for d1z7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1z7ub_: