Lineage for d1z7ub1 (1z7u B:1-107)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) 
contains a small beta-sheet (wing)
Family a.4.5.69: HxlR-like [140304] (5 proteins)
Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))
Protein Hypothetical protein EF0647 [140309] (1 species) Species Enterococcus faecalis [TaxId:1351] [140310] (1 PDB entry)
Uniprot Q838C3 1-108
Domain d1z7ub1: 1z7u B:1-107 [124673]
automatically matched to 1Z7U A:1-108
complexed with fmt
Details for d1z7ub1
PDB Entry: 1z7u (more details), 2.2 Å
PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
PDB Compounds: (B:) hypothetical protein EF0647SCOP Domain Sequences for d1z7ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ub1 a.4.5.69 (B:1-107) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]}
mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd
glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl
SCOP Domain Coordinates for d1z7ub1:
Click to download the PDB-style file with coordinates for d1z7ub1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z7ub1:
- d1z7ub1 first appeared in SCOP 1.73
- d1z7ub1 is called d1z7ub_ in SCOPe 2.01
- d1z7ub1 appears in the current release, SCOPe 2.08, called d1z7ub2
View in 3D
