![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.69: HxlR-like [140304] (5 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801)) |
![]() | Protein Hypothetical protein EF0647 [140309] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [140310] (1 PDB entry) Uniprot Q838C3 1-108 |
![]() | Domain d1z7ub1: 1z7u B:1-107 [124673] automatically matched to 1Z7U A:1-108 complexed with fmt |
PDB Entry: 1z7u (more details), 2.2 Å
SCOP Domain Sequences for d1z7ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ub1 a.4.5.69 (B:1-107) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl
Timeline for d1z7ub1: