Lineage for d1z7ub2 (1z7u B:1-107)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694402Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 2694421Protein automated matches [190851] (1 species)
    not a true protein
  7. 2694422Species Enterococcus faecalis [TaxId:226185] [188172] (1 PDB entry)
  8. 2694423Domain d1z7ub2: 1z7u B:1-107 [124673]
    Other proteins in same PDB: d1z7ua1, d1z7ua2, d1z7ub3
    automated match to d1z7ua1
    complexed with fmt

Details for d1z7ub2

PDB Entry: 1z7u (more details), 2.2 Å

PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
PDB Compounds: (B:) hypothetical protein EF0647

SCOPe Domain Sequences for d1z7ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ub2 a.4.5.69 (B:1-107) automated matches {Enterococcus faecalis [TaxId: 226185]}
mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd
glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarl

SCOPe Domain Coordinates for d1z7ub2:

Click to download the PDB-style file with coordinates for d1z7ub2.
(The format of our PDB-style files is described here.)

Timeline for d1z7ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z7ub3