Lineage for d1z7ua1 (1z7u A:1-108)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984048Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 1984049Protein Hypothetical protein EF0647 [140309] (1 species)
  7. 1984050Species Enterococcus faecalis [TaxId:1351] [140310] (1 PDB entry)
    Uniprot Q838C3 1-108
  8. 1984051Domain d1z7ua1: 1z7u A:1-108 [124672]
    Other proteins in same PDB: d1z7ua2, d1z7ub2, d1z7ub3
    complexed with fmt

Details for d1z7ua1

PDB Entry: 1z7u (more details), 2.2 Å

PDB Description: Crystal Structure of the Putitive Transcriptional Regulator of MarR Family from Enterococcus faecalis V583
PDB Compounds: (A:) hypothetical protein EF0647

SCOPe Domain Sequences for d1z7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]}
mttdkqtsinlalstingkwklslmdelfqgtkrngelmraldgitqrvltdrlremekd
glvhresfnelpprveytltpegyalydalsslchwgetfaqkkarln

SCOPe Domain Coordinates for d1z7ua1:

Click to download the PDB-style file with coordinates for d1z7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1z7ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z7ua2