Lineage for d1z7qo1 (1z7q O:10-252)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2988657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2990624Domain d1z7qo1: 1z7q O:10-252 [124661]
    Other proteins in same PDB: d1z7qd2, d1z7qh1, d1z7qi1, d1z7qj1, d1z7qk1, d1z7qm1, d1z7qn1, d1z7qr2, d1z7qv1, d1z7qw1, d1z7qx1, d1z7qy1
    automatically matched to d1g65g_

Details for d1z7qo1

PDB Entry: 1z7q (more details), 3.22 Å

PDB Description: Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator PA26 from Trypanosome brucei at 3.2 angstroms resolution
PDB Compounds: (O:) Proteasome component C7-alpha

SCOPe Domain Sequences for d1z7qo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7qo1 d.153.1.4 (O:10-252) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d1z7qo1:

Click to download the PDB-style file with coordinates for d1z7qo1.
(The format of our PDB-style files is described here.)

Timeline for d1z7qo1: