Lineage for d1z7qm1 (1z7q M:1-222)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (12 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 876369Domain d1z7qm1: 1z7q M:1-222 [124659]
    Other proteins in same PDB: d1z7qa1, d1z7qb1, d1z7qc1, d1z7qd1, d1z7qe1, d1z7qf1, d1z7qg1, d1z7qo1, d1z7qp1, d1z7qq1, d1z7qr1, d1z7qs1, d1z7qt1, d1z7qu1
    automatically matched to d1g0ul_

Details for d1z7qm1

PDB Entry: 1z7q (more details), 3.22 Å

PDB Description: Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator PA26 from Trypanosome brucei at 3.2 angstroms resolution
PDB Compounds: (M:) Potential proteasome component C5

SCOP Domain Sequences for d1z7qm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7qm1 d.153.1.4 (M:1-222) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOP Domain Coordinates for d1z7qm1:

Click to download the PDB-style file with coordinates for d1z7qm1.
(The format of our PDB-style files is described here.)

Timeline for d1z7qm1: