![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species) there is an additional C-terminal allosteric domain in some species |
![]() | Species Lactococcus lactis [TaxId:1358] [142804] (2 PDB entries) Uniprot Q02129 1-204 |
![]() | Domain d1z7nf1: 1z7n F:1-204 [124645] Other proteins in same PDB: d1z7na1, d1z7nb1, d1z7nc1, d1z7nd1 automatically matched to 1Z7M E:1-204 complexed with po4, prp |
PDB Entry: 1z7n (more details), 3.25 Å
SCOPe Domain Sequences for d1z7nf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7nf1 c.94.1.1 (F:1-204) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Lactococcus lactis [TaxId: 1358]} mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr mivnkssfkfkkdkiiemverled
Timeline for d1z7nf1: