Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species) shares histidine-binding site with the HisRS catalytic domain |
Species Lactococcus lactis [TaxId:1358] [143639] (2 PDB entries) Uniprot Q02147 6-323 |
Domain d1z7nb1: 1z7n B:6-323 [124641] Other proteins in same PDB: d1z7ne1, d1z7nf1, d1z7ng1, d1z7nh1 automatically matched to 1Z7M A:6-323 complexed with po4, prp has additional subdomain(s) that are not in the common domain |
PDB Entry: 1z7n (more details), 3.25 Å
SCOPe Domain Sequences for d1z7nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7nb1 d.104.1.1 (B:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai gfcchmdtilkalerqel
Timeline for d1z7nb1: