Lineage for d1z7mh1 (1z7m H:1-204)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710633Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
    there is an additional C-terminal allosteric domain in some species
  7. 710637Species Lactococcus lactis [TaxId:1358] [142804] (2 PDB entries)
  8. 710641Domain d1z7mh1: 1z7m H:1-204 [124639]
    Other proteins in same PDB: d1z7ma1, d1z7mb1, d1z7mc1, d1z7md1
    automatically matched to 1Z7M E:1-204
    complexed with po4, wo4

Details for d1z7mh1

PDB Entry: 1z7m (more details), 2.9 Å

PDB Description: ATP Phosphoribosyl transferase (HisZG ATP-PRTase) from Lactococcus lactis
PDB Compounds: (H:) ATP phosphoribosyltransferase

SCOP Domain Sequences for d1z7mh1:

Sequence, based on SEQRES records: (download)

>d1z7mh1 c.94.1.1 (H:1-204) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Lactococcus lactis [TaxId: 1358]}
mikiaitkgriqkqvtkllenadydvepilnlgrelqiktkddlqiifgkpndvitfleh
givdigfvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprv
tkkyfaqkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistr
mivnkssfkfkkdkiiemverled

Sequence, based on observed residues (ATOM records): (download)

>d1z7mh1 c.94.1.1 (H:1-204) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Lactococcus lactis [TaxId: 1358]}
mikiaitkgriqkqvtkllenadydvepilniktkddlqiifgkpndvitflehgivdig
fvgkdtldendfddyyellylkigqcifalasypdfsnknfqrhkriaskyprvtkkyfa
qkqedieiiklegsvelgpvvgladaivdivetgntlsangleviekisdistrmivnks
sfkfkkdkiiemverled

SCOP Domain Coordinates for d1z7mh1:

Click to download the PDB-style file with coordinates for d1z7mh1.
(The format of our PDB-style files is described here.)

Timeline for d1z7mh1: