Lineage for d1z7md_ (1z7m D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. Species Lactococcus lactis [TaxId:1358] [143639] (2 PDB entries)
    Uniprot Q02147 6-323
  8. Domain d1z7md_: 1z7m D: [124635]
    Other proteins in same PDB: d1z7me1, d1z7mf_, d1z7mg_, d1z7mh_
    automated match to d1z7ma1
    complexed with po4, wo4

Details for d1z7md_

PDB Entry: 1z7m (more details), 2.9 Å

PDB Description: ATP Phosphoribosyl transferase (HisZG ATP-PRTase) from Lactococcus lactis
PDB Compounds: (D:) ATP phosphoribosyltransferase regulatory subunit

SCOPe Domain Sequences for d1z7md_:

Sequence, based on SEQRES records: (download)

>d1z7md_ d.104.1.1 (D:) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]}
yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq
ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny
qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte
lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke
fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai
gfcchmdtilkalerqel

Sequence, based on observed residues (ATOM records): (download)

>d1z7md_ d.104.1.1 (D:) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]}
yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytaletfnqekmf
qfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrstenyqigi
elfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstelltelllk
kdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlkefsek
lsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafaigfcc
hmdtilkalerqel

SCOPe Domain Coordinates for d1z7md_ are not available.

Timeline for d1z7md_:

Domains from other chains:
(mouse over for more information)
d1z7ma1, d1z7mb_, d1z7mc_, d1z7me1, d1z7mf_, d1z7mg_, d1z7mh_