Lineage for d1z7mb_ (1z7m B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574277Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. 2574278Species Lactococcus lactis [TaxId:1358] [143639] (2 PDB entries)
    Uniprot Q02147 6-323
  8. 2574280Domain d1z7mb_: 1z7m B: [124633]
    Other proteins in same PDB: d1z7me1, d1z7mf_, d1z7mg_, d1z7mh_
    automated match to d1z7ma1
    complexed with po4, wo4

Details for d1z7mb_

PDB Entry: 1z7m (more details), 2.9 Å

PDB Description: ATP Phosphoribosyl transferase (HisZG ATP-PRTase) from Lactococcus lactis
PDB Compounds: (B:) ATP phosphoribosyltransferase regulatory subunit

SCOPe Domain Sequences for d1z7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7mb_ d.104.1.1 (B:) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]}
yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq
ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny
qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte
lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke
fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai
gfcchmdtilkalerqel

SCOPe Domain Coordinates for d1z7mb_:

Click to download the PDB-style file with coordinates for d1z7mb_.
(The format of our PDB-style files is described here.)

Timeline for d1z7mb_: