Lineage for d1z7mb1 (1z7m B:6-323)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869606Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 869649Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species)
    shares histidine-binding site with the HisRS catalytic domain
  7. 869650Species Lactococcus lactis [TaxId:1358] [143639] (2 PDB entries)
    Uniprot Q02147 6-323
  8. 869652Domain d1z7mb1: 1z7m B:6-323 [124633]
    Other proteins in same PDB: d1z7me1, d1z7mf1, d1z7mg1, d1z7mh1
    automatically matched to 1Z7M A:6-323
    complexed with po4, wo4

Details for d1z7mb1

PDB Entry: 1z7m (more details), 2.9 Å

PDB Description: ATP Phosphoribosyl transferase (HisZG ATP-PRTase) from Lactococcus lactis
PDB Compounds: (B:) ATP phosphoribosyltransferase regulatory subunit

SCOP Domain Sequences for d1z7mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7mb1 d.104.1.1 (B:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]}
yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq
ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny
qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte
lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke
fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai
gfcchmdtilkalerqel

SCOP Domain Coordinates for d1z7mb1:

Click to download the PDB-style file with coordinates for d1z7mb1.
(The format of our PDB-style files is described here.)

Timeline for d1z7mb1: