Lineage for d1z7kb_ (1z7k B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067522Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1067523Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1067524Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1067559Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 1067571Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)
  8. 1067598Domain d1z7kb_: 1z7k B: [124631]
    Other proteins in same PDB: d1z7ka_
    automated match to d1r0tb_

Details for d1z7kb_

PDB Entry: 1z7k (more details), 1.9 Å

PDB Description: crystal structure of trypsin- ovomucoid turkey egg white inhibitor complex
PDB Compounds: (B:) Ovomucoid

SCOPe Domain Sequences for d1z7kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7kb_ g.68.1.1 (B:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg
ec

SCOPe Domain Coordinates for d1z7kb_:

Click to download the PDB-style file with coordinates for d1z7kb_.
(The format of our PDB-style files is described here.)

Timeline for d1z7kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z7ka_