Class g: Small proteins [56992] (90 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins) |
Protein Ovomucoid domains [57469] (3 species) unless specified in the comment, the listed structures are of domain III |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (38 PDB entries) |
Domain d1z7kb1: 1z7k B:2-63 [124631] Other proteins in same PDB: d1z7ka1 automatically matched to d1r0tb_ complexed with nag |
PDB Entry: 1z7k (more details), 1.9 Å
SCOP Domain Sequences for d1z7kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg ec
Timeline for d1z7kb1: