SCOP 1.75: Domain d1z7kb1: 1z7k B:2-63

Lineage for d1z7kb1 (1z7k B:2-63)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (38 PDB entries)

8. Domain d1z7kb1: 1z7k B:2-63 [124631]
   Other proteins in same PDB: d1z7ka1
   automatically matched to d1r0tb_
   complexed with nag

Details for d1z7kb1

PDB Entry: 1z7k, 1.9 Å

PDB Description: crystal structure of trypsin- ovomucoid turkey egg white inhibitor complex

PDB Compounds: (B:) Ovomucoid

SCOP Domain Sequences for d1z7kb1:

Sequence; same for both SEQRES and ATOM records:

>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg
ec

Timeline for d1z7kb1:

• d1z7kb1 first appeared in SCOP 1.73
  
• d1z7kb1 is called d1z7kb_ in SCOPe 2.01
  
• d1z7kb1 appears in the current release, SCOPe 2.08, called d1z7kb_