Lineage for d1z7ee3 (1z7e E:1-200)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704461Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 704462Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 704463Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 704528Protein Polymyxin resistance protein ArnA, N-terminal domain [142569] (1 species)
  7. 704529Species Escherichia coli [TaxId:562] [142570] (3 PDB entries)
  8. 704537Domain d1z7ee3: 1z7e E:1-200 [124620]
    Other proteins in same PDB: d1z7ea1, d1z7ea2, d1z7eb1, d1z7eb2, d1z7ec1, d1z7ec2, d1z7ed1, d1z7ed2, d1z7ee1, d1z7ee2, d1z7ef1, d1z7ef2
    automatically matched to 1Z7E A:1-200
    complexed with atp, uga

Details for d1z7ee3

PDB Entry: 1z7e (more details), 3 Å

PDB Description: Crystal structure of full length ArnA
PDB Compounds: (E:) protein ArnA

SCOP Domain Sequences for d1z7ee3:

Sequence, based on SEQRES records: (download)

>d1z7ee3 c.65.1.1 (E:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgr

Sequence, based on observed residues (ATOM records): (download)

>d1z7ee3 c.65.1.1 (E:1-200) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]}
mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
aqreneatcfgr

SCOP Domain Coordinates for d1z7ee3:

Click to download the PDB-style file with coordinates for d1z7ee3.
(The format of our PDB-style files is described here.)

Timeline for d1z7ee3: