Lineage for d1z7ed1 (1z7e D:201-304)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404076Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 2404092Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)
  7. 2404093Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
    Uniprot P77398 201-304! Uniprot P77398 204-304
  8. 2404100Domain d1z7ed1: 1z7e D:201-304 [124615]
    Other proteins in same PDB: d1z7ea2, d1z7ea3, d1z7eb2, d1z7eb3, d1z7ec2, d1z7ec3, d1z7ed2, d1z7ed3, d1z7ee2, d1z7ee3, d1z7ef2, d1z7ef3
    automated match to d1z7ea1
    complexed with atp, uga

Details for d1z7ed1

PDB Entry: 1z7e (more details), 3 Å

PDB Description: Crystal structure of full length ArnA
PDB Compounds: (D:) protein ArnA

SCOPe Domain Sequences for d1z7ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ed1 b.46.1.1 (D:201-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
rtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvi
svaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl

SCOPe Domain Coordinates for d1z7ed1:

Click to download the PDB-style file with coordinates for d1z7ed1.
(The format of our PDB-style files is described here.)

Timeline for d1z7ed1: