Lineage for d1z7ah_ (1z7a H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850697Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 2850701Protein automated matches [190850] (3 species)
    not a true protein
  7. 2850707Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188171] (1 PDB entry)
  8. 2850714Domain d1z7ah_: 1z7a H: [124598]
    Other proteins in same PDB: d1z7aa1
    automated match to d1z7aa1
    complexed with edo, gol, ipa

Details for d1z7ah_

PDB Entry: 1z7a (more details), 1.71 Å

PDB Description: crystal structure of probable polysaccharide deacetylase from pseudomonas aeruginosa pao1
PDB Compounds: (H:) conserved hypothetical protein

SCOPe Domain Sequences for d1z7ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ah_ c.6.2.6 (H:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
yprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqplq
gvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadgheic
shgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfly
dsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvly
eegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpfq
e

SCOPe Domain Coordinates for d1z7ah_:

Click to download the PDB-style file with coordinates for d1z7ah_.
(The format of our PDB-style files is described here.)

Timeline for d1z7ah_: