Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.6: PA1517-like [141965] (2 proteins) seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522) |
Protein automated matches [190850] (3 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188171] (1 PDB entry) |
Domain d1z7ag_: 1z7a G: [124597] Other proteins in same PDB: d1z7aa1 automated match to d1z7aa1 complexed with edo, gol, ipa |
PDB Entry: 1z7a (more details), 1.71 Å
SCOPe Domain Sequences for d1z7ag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ag_ c.6.2.6 (G:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} dyprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqpl qgvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadghei cshgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfl ydsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvl yeegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpf q
Timeline for d1z7ag_: