SCOPe 2.08: Domain d1z7af_: 1z7a F:

Lineage for d1z7af_ (1z7a F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.6: PA1517-like [141965] (2 proteins)
   seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)

6. Protein automated matches [190850] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188171] (1 PDB entry)

8. Domain d1z7af_: 1z7a F: [124596]
   Other proteins in same PDB: d1z7aa1
   automated match to d1z7aa1
   complexed with edo, gol, ipa

Details for d1z7af_

PDB Entry: 1z7a, 1.71 Å

PDB Description: crystal structure of probable polysaccharide deacetylase from pseudomonas aeruginosa pao1

PDB Compounds: (F:) conserved hypothetical protein

SCOPe Domain Sequences for d1z7af_:

Sequence; same for both SEQRES and ATOM records:

>d1z7af_ c.6.2.6 (F:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
yprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqplq
gvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadgheic
shgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfly
dsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvly
eegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpfq
e

Timeline for d1z7af_:

• d1z7af_ first appeared in SCOP 1.73, called d1z7af1
  
• d1z7af_ appears in SCOPe 2.07