Lineage for d1z7ae_ (1z7a E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833746Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1833871Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 1833875Protein automated matches [190850] (3 species)
    not a true protein
  7. 1833881Species Pseudomonas aeruginosa [TaxId:208964] [188171] (1 PDB entry)
  8. 1833885Domain d1z7ae_: 1z7a E: [124595]
    Other proteins in same PDB: d1z7aa1
    automated match to d1z7aa1
    complexed with edo, gol, ipa

Details for d1z7ae_

PDB Entry: 1z7a (more details), 1.71 Å

PDB Description: crystal structure of probable polysaccharide deacetylase from pseudomonas aeruginosa pao1
PDB Compounds: (E:) conserved hypothetical protein

SCOPe Domain Sequences for d1z7ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ae_ c.6.2.6 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
dyprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqpl
qgvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadghei
cshgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfl
ydsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvl
yeegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpf
q

SCOPe Domain Coordinates for d1z7ae_:

Click to download the PDB-style file with coordinates for d1z7ae_.
(The format of our PDB-style files is described here.)

Timeline for d1z7ae_: