Lineage for d1z7ad1 (1z7a D:5-304)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689661Family c.6.2.6: PA1517-like [141965] (1 protein)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 689662Protein Hypothetical protein PA1517 [141966] (1 species)
  7. 689663Species Pseudomonas aeruginosa [TaxId:287] [141967] (1 PDB entry)
  8. 689667Domain d1z7ad1: 1z7a D:5-304 [124594]
    automatically matched to 1Z7A A:4-304
    complexed with edo, gol, ipa

Details for d1z7ad1

PDB Entry: 1z7a (more details), 1.71 Å

PDB Description: crystal structure of probable polysaccharide deacetylase from pseudomonas aeruginosa pao1
PDB Compounds: (D:) conserved hypothetical protein

SCOP Domain Sequences for d1z7ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7ad1 c.6.2.6 (D:5-304) Hypothetical protein PA1517 {Pseudomonas aeruginosa [TaxId: 287]}
yprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqplq
gvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadgheic
shgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfly
dsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvly
eegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpfq

SCOP Domain Coordinates for d1z7ad1:

Click to download the PDB-style file with coordinates for d1z7ad1.
(The format of our PDB-style files is described here.)

Timeline for d1z7ad1: