Lineage for d1z7aa1 (1z7a A:4-304)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458768Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2458862Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2458987Family c.6.2.6: PA1517-like [141965] (2 proteins)
    seven-stranded barrel with a detectable sequence similarity to the six-stranded barrel NodB-like family; member of the same Pfam family (Pfam PF01522)
  6. 2458988Protein Hypothetical protein PA1517 [141966] (1 species)
  7. 2458989Species Pseudomonas aeruginosa [TaxId:287] [141967] (1 PDB entry)
    Uniprot Q9I3J6 4-304
  8. 2458990Domain d1z7aa1: 1z7a A:4-304 [124591]
    Other proteins in same PDB: d1z7ab_, d1z7ac_, d1z7ad_, d1z7ae_, d1z7af_, d1z7ag_, d1z7ah_
    complexed with edo, gol, ipa

Details for d1z7aa1

PDB Entry: 1z7a (more details), 1.71 Å

PDB Description: crystal structure of probable polysaccharide deacetylase from pseudomonas aeruginosa pao1
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1z7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7aa1 c.6.2.6 (A:4-304) Hypothetical protein PA1517 {Pseudomonas aeruginosa [TaxId: 287]}
dyprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqpl
qgvrhmsmeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadghei
cshgyrwidyqymdeaqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggfl
ydsdtydddlpywdpastaekphlvipytldtndmrftqvqgfnngeqffqylkdafdvl
yeegatapkmlsiglhcrligrparmaalerfiqyaqshdkvwfarrediarhwhrehpf
q

SCOPe Domain Coordinates for d1z7aa1:

Click to download the PDB-style file with coordinates for d1z7aa1.
(The format of our PDB-style files is described here.)

Timeline for d1z7aa1: