Lineage for d1z77a2 (1z77 A:76-200)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341256Protein Transcriptional regulator TM1030 [140877] (1 species)
  7. 2341257Species Thermotoga maritima [TaxId:2336] [140878] (8 PDB entries)
    Uniprot Q9X0C0 76-200
  8. 2341265Domain d1z77a2: 1z77 A:76-200 [124589]
    Other proteins in same PDB: d1z77a1
    complexed with edo

Details for d1z77a2

PDB Entry: 1z77 (more details), 2 Å

PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.
PDB Compounds: (A:) transcriptional regulator (TetR family)

SCOPe Domain Sequences for d1z77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z77a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk

SCOPe Domain Coordinates for d1z77a2:

Click to download the PDB-style file with coordinates for d1z77a2.
(The format of our PDB-style files is described here.)

Timeline for d1z77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z77a1