SCOPe 2.02: Domain d1z77a2: 1z77 A:76-200

Lineage for d1z77a2 (1z77 A:76-200)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Transcriptional regulator TM1030 [140877] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140878] (4 PDB entries)
   Uniprot Q9X0C0 76-200

8. Domain d1z77a2: 1z77 A:76-200 [124589]
   Other proteins in same PDB: d1z77a1
   complexed with edo

Details for d1z77a2

PDB Entry: 1z77, 2 Å

PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.

PDB Compounds: (A:) transcriptional regulator (TetR family)

SCOPe Domain Sequences for d1z77a2:

Sequence; same for both SEQRES and ATOM records:

>d1z77a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk

Timeline for d1z77a2:

• d1z77a2 first appeared in SCOP 1.73
  
• d1z77a2 appears in SCOPe 2.01
  
• d1z77a2 appears in SCOPe 2.03
  
• d1z77a2 appears in the current release, SCOPe 2.08