![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
![]() | Protein Transcriptional regulator TM1030 [140877] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [140878] (4 PDB entries) Uniprot Q9X0C0 76-200 |
![]() | Domain d1z77a2: 1z77 A:76-200 [124589] Other proteins in same PDB: d1z77a1 complexed with edo |
PDB Entry: 1z77 (more details), 2 Å
SCOP Domain Sequences for d1z77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z77a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk kgmtk
Timeline for d1z77a2: