Lineage for d1z77a2 (1z77 A:76-200)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776253Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 776254Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 776255Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 776475Protein Transcriptional regulator TM1030 [140877] (1 species)
  7. 776476Species Thermotoga maritima [TaxId:2336] [140878] (4 PDB entries)
    Uniprot Q9X0C0 76-200
  8. 776479Domain d1z77a2: 1z77 A:76-200 [124589]
    Other proteins in same PDB: d1z77a1
    complexed with edo

Details for d1z77a2

PDB Entry: 1z77 (more details), 2 Å

PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.
PDB Compounds: (A:) transcriptional regulator (TetR family)

SCOP Domain Sequences for d1z77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z77a2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk

SCOP Domain Coordinates for d1z77a2:

Click to download the PDB-style file with coordinates for d1z77a2.
(The format of our PDB-style files is described here.)

Timeline for d1z77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z77a1