SCOPe 2.06: Domain d1z77a1: 1z77 A:1-75

Lineage for d1z77a1 (1z77 A:1-75)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator TM1030 [140209] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
   Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75

8. Domain d1z77a1: 1z77 A:1-75 [124588]
   Other proteins in same PDB: d1z77a2
   complexed with edo

Details for d1z77a1

PDB Entry: 1z77, 2 Å

PDB Description: crystal structure of transcriptional regulator protein from thermotoga maritima.

PDB Compounds: (A:) transcriptional regulator (TetR family)

SCOPe Domain Sequences for d1z77a1:

Sequence; same for both SEQRES and ATOM records:

>d1z77a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
klqkefenflmknrn

Timeline for d1z77a1:

• d1z77a1 first appeared in SCOP 1.73
  
• d1z77a1 appears in SCOPe 2.05
  
• d1z77a1 appears in SCOPe 2.07
  
• d1z77a1 appears in the current release, SCOPe 2.08