Lineage for d1z72b1 (1z72 B:3-220)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 649094Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 649122Protein Putative transcriptional regulator SP0716 (SPr0628) [140954] (1 species)
  7. 649123Species Streptococcus pneumoniae [TaxId:1313] [140955] (2 PDB entries)
  8. 649125Domain d1z72b1: 1z72 B:3-220 [124584]
    automatically matched to 2A6B A:3-221
    complexed with acy, mg

Details for d1z72b1

PDB Entry: 1z72 (more details), 1.45 Å

PDB Description: Structure of a putative transcriptional regulator from Streptococcus pneumoniae
PDB Compounds: (B:) Transcriptional regulator, putative

SCOP Domain Sequences for d1z72b1:

Sequence, based on SEQRES records: (download)

>d1z72b1 a.132.1.3 (B:3-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgknredltelqqrwnqavalelaffdigy

Sequence, based on observed residues (ATOM records): (download)

>d1z72b1 a.132.1.3 (B:3-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgkrltelqqrwnqavalelaffdigy

SCOP Domain Coordinates for d1z72b1:

Click to download the PDB-style file with coordinates for d1z72b1.
(The format of our PDB-style files is described here.)

Timeline for d1z72b1: