Lineage for d1z72b_ (1z72 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. Protein automated matches [190172] (9 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:170187] [186901] (1 PDB entry)
  8. Domain d1z72b_: 1z72 B: [124584]
    automated match to d1to9b_
    complexed with acy, mg

Details for d1z72b_

PDB Entry: 1z72 (more details), 1.45 Å

PDB Description: Structure of a putative transcriptional regulator from Streptococcus pneumoniae
PDB Compounds: (B:) Transcriptional regulator, putative

SCOPe Domain Sequences for d1z72b_:

Sequence, based on SEQRES records: (download)

>d1z72b_ a.132.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgknredltelqqrwnqavalelaffdigy

Sequence, based on observed residues (ATOM records): (download)

>d1z72b_ a.132.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgkrltelqqrwnqavalelaffdigy

SCOPe Domain Coordinates for d1z72b_ are not available.

Timeline for d1z72b_:

Domains from other chains:
(mouse over for more information)
d1z72a_