Lineage for d1z72a_ (1z72 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098898Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1098899Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1099103Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 1099104Protein automated matches [190172] (6 species)
    not a true protein
  7. 1099127Species Streptococcus pneumoniae [TaxId:170187] [186901] (1 PDB entry)
  8. 1099128Domain d1z72a_: 1z72 A: [124583]
    automated match to d1to9b_
    complexed with acy, mg

Details for d1z72a_

PDB Entry: 1z72 (more details), 1.45 Å

PDB Description: Structure of a putative transcriptional regulator from Streptococcus pneumoniae
PDB Compounds: (A:) Transcriptional regulator, putative

SCOPe Domain Sequences for d1z72a_:

Sequence, based on SEQRES records: (download)

>d1z72a_ a.132.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafls
mlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkafq
dlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvqf
lvdelnrvgknredltelqqrwnqavalelaffdigy

Sequence, based on observed residues (ATOM records): (download)

>d1z72a_ a.132.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafls
mlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkafq
dlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvqf
lvdelnrvgkredltelqqrwnqavalelaffdigy

SCOPe Domain Coordinates for d1z72a_:

Click to download the PDB-style file with coordinates for d1z72a_.
(The format of our PDB-style files is described here.)

Timeline for d1z72a_: