Lineage for d1z6za1 (1z6z A:2-258)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820631Protein Sepiapterin reductase [51767] (2 species)
  7. 820632Species Human (Homo sapiens) [TaxId:9606] [141874] (1 PDB entry)
    Uniprot P35270 5-261
  8. 820633Domain d1z6za1: 1z6z A:2-258 [124575]
    complexed with cl, nap, so4

Details for d1z6za1

PDB Entry: 1z6z (more details), 2.5 Å

PDB Description: crystal structure of human sepiapterin reductase in complex with nadp+
PDB Compounds: (A:) sepiapterin reductase

SCOP Domain Sequences for d1z6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6za1 c.2.1.2 (A:2-258) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
lgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrvv
rvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnnyw
alnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqvl
aleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqkllsl
lekdefksgahvdfydk

SCOP Domain Coordinates for d1z6za1:

Click to download the PDB-style file with coordinates for d1z6za1.
(The format of our PDB-style files is described here.)

Timeline for d1z6za1: