SCOP 1.73: Domain d1z6yb1: 1z6y B:3-175

Lineage for d1z6yb1 (1z6y B:3-175)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (14 species)

7. Species Human (Homo sapiens), ARL5A [TaxId:9606] [142218] (2 PDB entries)

8. Domain d1z6yb1: 1z6y B:3-175 [124574]
   automatically matched to 1ZJ6 A:2-178
   complexed with gdp

Details for d1z6yb1

PDB Entry: 1z6y, 2.4 Å

PDB Description: Structure Of Human ADP-Ribosylation Factor-Like 5

PDB Compounds: (B:) ADP-ribosylation factor-like protein 5

SCOP Domain Sequences for d1z6yb1:

Sequence, based on SEQRES records:

>d1z6yb1 c.37.1.8 (B:3-175) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}
ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf
lmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkaglli
fankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr

Sequence, based on observed residues (ATOM records):

>d1z6yb1 c.37.1.8 (B:3-175) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}
ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf
lmwdiggqeslrsyytntefvivvvdstdrerisvtreelykmlahedlrkagllifank
qdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr

Timeline for d1z6yb1:

• d1z6yb1 is new in SCOP 1.73
  
• d1z6yb1 appears in SCOP 1.75
  
• d1z6yb1 appears in the current release, SCOPe 2.08, called d1z6yb_