![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein ADP-ribosylation factor [52614] (14 species) |
![]() | Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry) |
![]() | Domain d1z6xb1: 1z6x B:4-178 [124572] automatically matched to 1Z6X A:4-178 complexed with gdp, mg |
PDB Entry: 1z6x (more details), 2.7 Å
SCOP Domain Sequences for d1z6xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6xb1 c.37.1.8 (B:4-178) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]} tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels
Timeline for d1z6xb1: