Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (17 species) |
Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry) Uniprot P18085 3-177 |
Domain d1z6xb_: 1z6x B: [124572] automated match to d1hura_ complexed with gdp, mg |
PDB Entry: 1z6x (more details), 2.7 Å
SCOPe Domain Sequences for d1z6xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6xb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]} tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels
Timeline for d1z6xb_: