Lineage for d1z6xb_ (1z6x B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866711Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry)
    Uniprot P18085 3-177
  8. 2866713Domain d1z6xb_: 1z6x B: [124572]
    automated match to d1hura_
    complexed with gdp, mg

Details for d1z6xb_

PDB Entry: 1z6x (more details), 2.7 Å

PDB Description: Structure Of Human ADP-Ribosylation Factor 4
PDB Compounds: (B:) ADP-ribosylation factor 4

SCOPe Domain Sequences for d1z6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6xb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]}
tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels

SCOPe Domain Coordinates for d1z6xb_:

Click to download the PDB-style file with coordinates for d1z6xb_.
(The format of our PDB-style files is described here.)

Timeline for d1z6xb_: