SCOPe 2.02: Domain d1z6xa1: 1z6x A:4-178

Lineage for d1z6xa1 (1z6x A:4-178)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (15 species)

7. Species Human (Homo sapiens), ARF4 [TaxId:9606] [142217] (1 PDB entry)
   Uniprot P18085 3-177

8. Domain d1z6xa1: 1z6x A:4-178 [124571]
   complexed with gdp, mg

Details for d1z6xa1

PDB Entry: 1z6x, 2.7 Å

PDB Description: Structure Of Human ADP-Ribosylation Factor 4

PDB Compounds: (A:) ADP-ribosylation factor 4

SCOPe Domain Sequences for d1z6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1z6xa1 c.37.1.8 (A:4-178) ADP-ribosylation factor {Human (Homo sapiens), ARF4 [TaxId: 9606]}
tisslfsrlfgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicf
tvwdvggqdrirplwkhyfqntqglifvvdsndreriqevadelqkmllvdelrdavlll
fankqdlpnamaisemtdklglqslrnrtwyvqatcatqgtglyegldwlsnels

Timeline for d1z6xa1:

• d1z6xa1 first appeared in SCOP 1.73
  
• d1z6xa1 appears in SCOPe 2.01
  
• d1z6xa1 appears in SCOPe 2.03
  
• d1z6xa1 appears in the current release, SCOPe 2.08