Lineage for d1z6rd3 (1z6r D:211-406)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171849Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 1171860Protein Mlc protein [142473] (1 species)
    Making large colonies protein
  7. 1171861Species Escherichia coli [TaxId:562] [142474] (2 PDB entries)
    Uniprot P50456 211-406! Uniprot P50456 82-210
  8. 1171869Domain d1z6rd3: 1z6r D:211-406 [124568]
    Other proteins in same PDB: d1z6ra1, d1z6rb1, d1z6rc1, d1z6rd1
    automatically matched to 1Z6R A:211-406
    complexed with zn

Details for d1z6rd3

PDB Entry: 1z6r (more details), 2.7 Å

PDB Description: crystal structure of mlc from escherichia coli
PDB Compounds: (D:) Mlc protein

SCOPe Domain Sequences for d1z6rd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6rd3 c.55.1.10 (D:211-406) Mlc protein {Escherichia coli [TaxId: 562]}
gardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgcletias
vdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgrilaimv
nlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtmagaalv
kdamyngsllirllqg

SCOPe Domain Coordinates for d1z6rd3:

Click to download the PDB-style file with coordinates for d1z6rd3.
(The format of our PDB-style files is described here.)

Timeline for d1z6rd3: