Lineage for d1z6rd1 (1z6r D:12-81)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983481Family a.4.5.63: ROK associated domain [140279] (3 protein domains)
    found N-terminal to ROK domain in some proteins
  6. 1983482Protein Mlc protein N-terminal domain [140280] (1 species)
  7. 1983483Species Escherichia coli [TaxId:562] [140281] (2 PDB entries)
    Uniprot P50456 12-81
  8. 1983487Domain d1z6rd1: 1z6r D:12-81 [124566]
    Other proteins in same PDB: d1z6ra2, d1z6ra3, d1z6rb2, d1z6rb3, d1z6rc2, d1z6rc3, d1z6rd2, d1z6rd3
    automated match to d1z6ra1
    complexed with zn

Details for d1z6rd1

PDB Entry: 1z6r (more details), 2.7 Å

PDB Description: Crystal structure of Mlc from Escherichia coli
PDB Compounds: (D:) Mlc protein

SCOPe Domain Sequences for d1z6rd1:

Sequence, based on SEQRES records: (download)

>d1z6rd1 a.4.5.63 (D:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqeleikeagnr
grpavglvve

Sequence, based on observed residues (ATOM records): (download)

>d1z6rd1 a.4.5.63 (D:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvve

SCOPe Domain Coordinates for d1z6rd1:

Click to download the PDB-style file with coordinates for d1z6rd1.
(The format of our PDB-style files is described here.)

Timeline for d1z6rd1: