SCOP 1.75: Domain d1z6rc1: 1z6r C:12-81

Lineage for d1z6rc1 (1z6r C:12-81)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.63: ROK associated domain [140279] (3 proteins)
   found N-terminal to ROK domain in some proteins

6. Protein Mlc protein N-terminal domain [140280] (1 species)

7. Species Escherichia coli [TaxId:562] [140281] (2 PDB entries)
   Uniprot P50456 12-81

8. Domain d1z6rc1: 1z6r C:12-81 [124563]
   Other proteins in same PDB: d1z6ra2, d1z6ra3, d1z6rb2, d1z6rb3, d1z6rc2, d1z6rc3, d1z6rd2, d1z6rd3
   automatically matched to 1Z6R A:12-81
   complexed with zn; mutant

Details for d1z6rc1

PDB Entry: 1z6r, 2.7 Å

PDB Description: crystal structure of mlc from escherichia coli

PDB Compounds: (C:) Mlc protein

SCOP Domain Sequences for d1z6rc1:

Sequence, based on SEQRES records:

>d1z6rc1 a.4.5.63 (C:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqeleikeagnr
grpavglvve

Sequence, based on observed residues (ATOM records):

>d1z6rc1 a.4.5.63 (C:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvve

Timeline for d1z6rc1:

• d1z6rc1 first appeared in SCOP 1.73
  
• d1z6rc1 appears in SCOPe 2.01
  
• d1z6rc1 appears in the current release, SCOPe 2.08