Lineage for d1z6rb2 (1z6r B:82-210)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701817Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 701828Protein Mlc protein [142473] (1 species)
    Making large colonies protein
  7. 701829Species Escherichia coli [TaxId:562] [142474] (1 PDB entry)
  8. 701832Domain d1z6rb2: 1z6r B:82-210 [124561]
    Other proteins in same PDB: d1z6ra1, d1z6rb1, d1z6rc1, d1z6rd1
    automatically matched to 1Z6R A:82-210
    complexed with zn; mutant

Details for d1z6rb2

PDB Entry: 1z6r (more details), 2.7 Å

PDB Description: crystal structure of mlc from escherichia coli
PDB Compounds: (B:) Mlc protein

SCOP Domain Sequences for d1z6rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6rb2 c.55.1.10 (B:82-210) Mlc protein {Escherichia coli [TaxId: 562]}
teawhylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqk
klerltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtm
aealfgasr

SCOP Domain Coordinates for d1z6rb2:

Click to download the PDB-style file with coordinates for d1z6rb2.
(The format of our PDB-style files is described here.)

Timeline for d1z6rb2: