![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein Mlc protein [142473] (1 species) Making large colonies protein |
![]() | Species Escherichia coli [TaxId:562] [142474] (2 PDB entries) Uniprot P50456 211-406! Uniprot P50456 82-210 |
![]() | Domain d1z6ra2: 1z6r A:82-210 [124558] Other proteins in same PDB: d1z6ra1, d1z6rb1, d1z6rc1, d1z6rd1 complexed with zn |
PDB Entry: 1z6r (more details), 2.7 Å
SCOPe Domain Sequences for d1z6ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} teawhylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqk klerltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtm aealfgasr
Timeline for d1z6ra2: