![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.63: ROK associated domain [140279] (3 proteins) found N-terminal to ROK domain in some proteins |
![]() | Protein Mlc protein N-terminal domain [140280] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [140281] (2 PDB entries) Uniprot P50456 12-81 |
![]() | Domain d1z6ra1: 1z6r A:12-81 [124557] Other proteins in same PDB: d1z6ra2, d1z6ra3, d1z6rb2, d1z6rb3, d1z6rc2, d1z6rc3, d1z6rd2, d1z6rd3 complexed with zn |
PDB Entry: 1z6r (more details), 2.7 Å
SCOPe Domain Sequences for d1z6ra1:
Sequence, based on SEQRES records: (download)
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqeleikeagnr grpavglvve
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvve
Timeline for d1z6ra1: