Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1z6ow_ (1z6o W:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (12 species)
    not a true protein
  7. Species Trichoplusia ni [TaxId:7111] [186900] (1 PDB entry)
  8. Domain d1z6ow_: 1z6o W: [124553]
    Other proteins in same PDB: d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1
    automated match to d1rcd__
    complexed with ca, fe

Details for d1z6ow_

PDB Entry: 1z6o (more details)
PDB Description: crystal structure of trichoplusia ni secreted ferritin
PDB Compounds: (W:) ferritin heavy chain

SCOP Domain Sequences for d1z6ow_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6ow_ a.25.1.0 (W:) automated matches {Trichoplusia ni [TaxId: 7111]}
tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
ifdkkllgidv

SCOP Domain Coordinates for d1z6ow_:

Click to download the PDB-style file with coordinates for d1z6ow_.
(The format of our PDB-style files is described here.)

Timeline for d1z6ow_:

d1z6ow_ appears in SCOP 1.75A


d1z6ow_
(click for larger image)


d1z6ow_ in context of chain



d1z6ow_ in context of PDB
Domains from other chains:
d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ox_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu