Lineage for d1z6os1 (1z6o S:1-191)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638521Protein (Apo)ferritin [47246] (7 species)
  7. 638553Species Cabbage looper(Trichoplusia ni), H chain [TaxId:7111] [140437] (1 PDB entry)
  8. 638560Domain d1z6os1: 1z6o S:1-191 [124549]
    automatically matched to 1Z6O M:1-191
    complexed with ca, fe

Details for d1z6os1

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (S:) ferritin heavy chain

SCOP Domain Sequences for d1z6os1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6os1 a.25.1.1 (S:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]}
tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
ifdkkllgidv

SCOP Domain Coordinates for d1z6os1:

Click to download the PDB-style file with coordinates for d1z6os1.
(The format of our PDB-style files is described here.)

Timeline for d1z6os1: