Lineage for d1z6oo_ (1z6o O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705243Species Trichoplusia ni [TaxId:7111] [186900] (1 PDB entry)
  8. 2705245Domain d1z6oo_: 1z6o O: [124545]
    Other proteins in same PDB: d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6om1
    automated match to d1rcd__
    complexed with ca, fe

Details for d1z6oo_

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (O:) ferritin heavy chain

SCOPe Domain Sequences for d1z6oo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6oo_ a.25.1.0 (O:) automated matches {Trichoplusia ni [TaxId: 7111]}
tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
ifdkkllgidv

SCOPe Domain Coordinates for d1z6oo_:

Click to download the PDB-style file with coordinates for d1z6oo_.
(The format of our PDB-style files is described here.)

Timeline for d1z6oo_: