Domain d1z6om1: 1z6o M:1-191

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d1z6om1 (1z6o M:1-191)

Root: SCOP 1.75B
Class a: All alpha proteins [46456] (284 folds)
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
Superfamily a.25.1: Ferritin-like [47240] (10 families)
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.1: Ferritin [47241] (10 protein domains)
Protein (Apo)ferritin [47246] (8 species)
Species Cabbage looper (Trichoplusia ni), H chain [TaxId:7111] [140437] (1 PDB entry)
Uniprot Q8WQX3 21-211

PDB Entry: 1z6o (more details)
PDB Description: crystal structure of trichoplusia ni secreted ferritin
PDB Compounds: (M:) ferritin heavy chain

SCOP Domain Sequences for d1z6om1:
Sequence; same for both SEQRES and ATOM records: (download)

>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper (Trichoplusia ni), H chain [TaxId: 7111]} tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef ifdkkllgidv

SCOP Domain Coordinates for d1z6om1:

Click to download the PDB-style file with coordinates for d1z6om1.
(The format of our PDB-style files is described here.)

Timeline for d1z6om1:
d1z6om1 appears in SCOP 1.75A

d1z6om1
(click for larger image)

d1z6om1 in context of chain

d1z6om1 in context of PDB
Domains from other chains:
d1z6oa1, d1z6ob_, d1z6oc_, d1z6od_, d1z6oe_, d1z6of_, d1z6og_, d1z6oh_, d1z6oi_, d1z6oj_, d1z6ok_, d1z6ol_, d1z6on_, d1z6oo_, d1z6op_, d1z6oq_, d1z6or_, d1z6os_, d1z6ot_, d1z6ou_, d1z6ov_, d1z6ow_, d1z6ox_